PDB entry 1pnt

View 1pnt on RCSB PDB site
Description: crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 1994-08-05, released 1995-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acid phosphatase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pnta_
  • Heterogens: PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pntA (A:)
    aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
    sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
    pqkqliiedpyygndadfetvyqqcvrccraflekvr