PDB entry 1pnq

View 1pnq on RCSB PDB site
Description: Crystal structure of R. rubrum transhydrogenase domain III bound to NADPH
Class: oxidoreductase
Keywords: Nucleotide binding fold, NADPH, OXIDOREDUCTASE
Deposited on 2003-06-12, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59765 (9-179)
      • cloning artifact (0-8)
    Domains in SCOPe 2.07: d1pnqa1, d1pnqa2
  • Chain 'B':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59765 (9-179)
      • cloning artifact (3-8)
    Domains in SCOPe 2.07: d1pnqb1, d1pnqb2
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnqA (A:)
    sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
    ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
    spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pnqB (B:)
    sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
    ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
    spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pnqB (B:)
    iegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihp
    vagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspi
    ygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn