PDB entry 1pno

View 1pno on RCSB PDB site
Description: Crystal structure of R. rubrum transhydrogenase domain III bound to NADP
Deposited on 2003-06-12, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pnoa_
  • Chain 'B':
    Domains in SCOP 1.67: d1pnob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnoA (A:)
    sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
    ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
    spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pnoB (B:)
    sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
    ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
    spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pnoB (B:)
    iegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihp
    vagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspi
    ygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn