PDB entry 1pno

View 1pno on RCSB PDB site
Description: Crystal structure of R. rubrum transhydrogenase domain III bound to NADP
Class: oxidoreductase
Keywords: Nucleotide binding fold, NADP, oxidoreductase
Deposited on 2003-06-12, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: PNTB OR NNTB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59765 (9-179)
      • cloning artifact (0-8)
    Domains in SCOPe 2.07: d1pnoa1, d1pnoa2
  • Chain 'B':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: PNTB OR NNTB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59765 (9-179)
      • cloning artifact (3-8)
    Domains in SCOPe 2.07: d1pnob1, d1pnob2
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnoA (A:)
    sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
    ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
    spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pnoB (B:)
    sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
    ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
    spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pnoB (B:)
    iegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihp
    vagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspi
    ygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn