PDB entry 1pnj

View 1pnj on RCSB PDB site
Description: solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1993-07-19, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23727 (Start-85)
  Domains in SCOPe 2.08: d1pnja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pnjA (A:)
  gsmsaegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqeakpeeigwlng
  ynettgergdfpgtyveyigrkkisp