PDB entry 1png

View 1png on RCSB PDB site
Description: crystal structure of peptide-n(4)-(n-acetyl-beta-d-glucosaminyl) asparagine amidase at 2.2 angstroms resolution
Deposited on 1994-06-02, released 1994-11-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1png_ (-)
    ntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewdryan
    vyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetwlakg
    reysvdfdivygtpdykysavvpviqynkssidgvpygkahtlglkkniqlptntekayl
    rttisgwghakpydagsrgcaewcfrthtiainnantfqhqlgalgcsanpinnqspgnw
    apdragwcpgmavptridvlnnsltgstfsyeykfqswtnngtngdafyaissfviaksn
    tpisapvvtn