PDB entry 1pnf

View 1pnf on RCSB PDB site
Description: pngase f complex with di-n-acetylchitobiose
Deposited on 1995-10-11, released 1996-03-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnf_ (-)
    apadntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewd
    ryanvyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetw
    lakgreysvdfdivygtpdykysavvpviqynkssidgvpygkahtlglkkniqlptnte
    kaylrttisgwghakpydagsrgcaewcfrthtiainnantfqhqlgalgcsanpinnqs
    pgnwapdragwcpgmavptridvlnnsltgstfsyeykfqswtnngtngdafyaissfvi
    aksntpisapvvtn