PDB entry 1pnf

View 1pnf on RCSB PDB site
Description: pngase f complex with di-n-acetylchitobiose
Class: hydrolase
Keywords: hydrolase
Deposited on 1995-10-11, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide-n(4)-(n-acetyl-beta-d-glucosaminyl)asparagine amidase f
    Species: Elizabethkingia meningoseptica [TaxId:238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pnfa1, d1pnfa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnfA (A:)
    apadntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewd
    ryanvyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetw
    lakgreysvdfdivygtpdykysavvpviqynkssidgvpygkahtlglkkniqlptnte
    kaylrttisgwghakpydagsrgcaewcfrthtiainnantfqhqlgalgcsanpinnqs
    pgnwapdragwcpgmavptridvlnnsltgstfsyeykfqswtnngtngdafyaissfvi
    aksntpisapvvtn