PDB entry 1pnc

View 1pnc on RCSB PDB site
Description: accuracy and precision in protein crystal structure analysis: two independent refinements of the structure of poplar plastocyanin at 173k
Class: electron transport
Keywords: electron transport
Deposited on 1993-09-22, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.132
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: Populus nigra
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pnca_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pncA (A:)
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn