PDB entry 1pn8

View 1pn8 on RCSB PDB site
Description: Coordinates of S12, L11 proteins and E-site tRNA from 70S crystal structure separately fitted into the Cryo-EM map of E.coli 70S.EF-G.GDPNP complex. The atomic coordinates originally from the E-site tRNA were fitted in the position of the hybrid P/E-site tRNA.
Class: RNA binding protein/RNA
Keywords: ribosomal protein, tRNA binding protein, tRNA
Deposited on 2003-06-12, released 2003-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-15, with a file datestamp of 2007-06-04.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: E-tRNA
  
• Chain 'L':
  Compound: 50S ribosomal protein L11
  Species: Thermotoga maritima
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29395 (0-132)
  Domains in SCOP 1.73: d1pn8l_
• Chain 'O':
  Compound: 30S ribosomal protein S12
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHN3 (0-123)
  Domains in SCOP 1.73: d1pn8o_

PDB Chain Sequences:

• Chain 'D':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pn8L (L:)
  qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
  fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
  iegtaksmgievv
  

  
  
• Chain 'O':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pn8O (O:)
  ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
  evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
  pkea