PDB entry 1pn6

View 1pn6 on RCSB PDB site
Description: Domain-wise fitting of the crystal structure of T.thermophilus EF-G into the low resolution map of the release complex.Puromycin.EFG.GDPNP of E.coli 70S ribosome.
Deposited on 2003-06-12, released 2003-07-15
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1pn6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pn6A (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyaevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn6A (A:)
    eydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdftie
    versmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirtm
    qerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqareyh
    eklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqlll
    davvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysg
    tltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvged
    aprvilesievpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisg
    mgelhleiivdrlkrefkvdanvgkpqvayretitkpvdvegkfirqtggrgqyghvkik
    veplprgsgfefvnaivggvipkeyipavqkgieeamqsgpligfpvvdikvtlydgsya
    evdssemafkiagsmaikeavqkgdpvilepimrvevttpeeymgdvigdlnarrgqilg
    meprgnaqvirafvplaemfgyatdlrsktqgrgsfvmffdhyqevpkqvqekli