PDB entry 1pn5

View 1pn5 on RCSB PDB site
Description: NMR structure of the NALP1 Pyrin domain (PYD)
Class: apoptosis
Keywords: 5 alpha-helix bundle, apoptosis
Deposited on 2003-06-12, released 2003-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NACHT-, LRR- and PYD-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NALP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pn5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1pn5A (A:)
mqyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvtegsma
ggawgrlacyleflkkeelkefqlllankahsrsssgetpaqpektsgmevasylvaqyg
eqrawdlalhtweqmglrslcaqaqegaghslehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1pn5A (A:)
maggawgrlacyleflkkeelkefqlllankahsrsssgetpaqpektsgmevasylvaq
ygeqrawdlalhtweqmglrslcaqaqegaghs