PDB entry 1pn4

View 1pn4 on RCSB PDB site
Description: Crystal structure of 2-enoyl-CoA hydratase 2 domain of Candida tropicalis multifunctional enzyme type 2 complexed with (3R)-hydroxydecanoyl-CoA.
Class: lyase
Keywords: Hot-Dog fold, Hydratase 2 motif, Oxyanion hole, Enzyme-product complex, LYASE
Deposited on 2003-06-12, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.3499999999999996 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal hydratase-dehydrogenase-epimerase
    Species: Candida tropicalis [TaxId:5482]
    Gene: FOX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22414
      • engineered (186)
    Domains in SCOPe 2.08: d1pn4a1, d1pn4a2
  • Chain 'B':
    Compound: Peroxisomal hydratase-dehydrogenase-epimerase
    Species: Candida tropicalis [TaxId:5482]
    Gene: FOX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22414
      • engineered (186)
    Domains in SCOPe 2.08: d1pn4b1, d1pn4b2
  • Chain 'C':
    Compound: Peroxisomal hydratase-dehydrogenase-epimerase
    Species: Candida tropicalis [TaxId:5482]
    Gene: FOX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22414
      • engineered (186)
    Domains in SCOPe 2.08: d1pn4c1, d1pn4c2
  • Chain 'D':
    Compound: Peroxisomal hydratase-dehydrogenase-epimerase
    Species: Candida tropicalis [TaxId:5482]
    Gene: FOX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22414
      • engineered (186)
    Domains in SCOPe 2.08: d1pn4d1, d1pn4d2
  • Heterogens: HDC, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pn4A (A:)
    meddpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfa
    kllrnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnks
    geliysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrls
    gdrnplqidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetl
    rvlawkesddtivfqthvvdrgtiainnaaiklvgdkaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn4A (A:)
    pvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakllr
    nfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgeli
    ysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrlsgdrn
    plqidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetlrvla
    wkesddtivfqthvvdrgtiainnaaiklvgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pn4B (B:)
    meddpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfa
    kllrnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnks
    geliysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrls
    gdrnplqidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetl
    rvlawkesddtivfqthvvdrgtiainnaaiklvgdkaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn4B (B:)
    pvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakllr
    nfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgeli
    ysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrlsgdrn
    plqidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetlrvla
    wkesddtivfqthvvdrgtiainnaaiklvgd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pn4C (C:)
    meddpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfa
    kllrnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnks
    geliysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrls
    gdrnplqidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetl
    rvlawkesddtivfqthvvdrgtiainnaaiklvgdkaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn4C (C:)
    dpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnlhgehylkvhsw
    ppptegeikttfepiattpvvivhgsksvdnksgeliysneatyfirncqadnkvyadrp
    afatnqflapkrapdyqvdvpvsedlaalyrlsgdrnplqidpnfakgakfpkpilhgmc
    tyglsakalidkfgmfneikarftgivfpgetlrvlawkesddtivfqthvvdrgtiain
    naaiklv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pn4D (D:)
    meddpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfa
    kllrnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnks
    geliysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrls
    gdrnplqidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetl
    rvlawkesddtivfqthvvdrgtiainnaaiklvgdkaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn4D (D:)
    dpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakll
    rnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgel
    iysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrlsgdr
    nplqidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetlrvl
    awkesddtivfqthvvdrgtiainnaaiklvgd