PDB entry 1pn2

View 1pn2 on RCSB PDB site
Description: crystal structure analysis of the selenomethionine labelled 2-enoyl- coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2
Deposited on 2003-06-12, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pn2A (A:)
    meddpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfa
    kllrnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnks
    geliysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrls
    gdrnplhidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetl
    rvlawkesddtivfqthvvdrgtiainnaaiklvgdkaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn2A (A:)
    dpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakll
    rnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgel
    iysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrlsgdr
    nplhidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetlrvl
    awkesddtivfqthvvdrgtiainnaaiklvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pn2B (B:)
    meddpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfa
    kllrnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnks
    geliysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrls
    gdrnplhidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetl
    rvlawkesddtivfqthvvdrgtiainnaaiklvgdkaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn2B (B:)
    pvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakllr
    nfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgeli
    ysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrlsgdrn
    plhidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetlrvla
    wkesddtivfqthvvdrgtiainnaaiklv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pn2C (C:)
    meddpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfa
    kllrnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnks
    geliysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrls
    gdrnplhidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetl
    rvlawkesddtivfqthvvdrgtiainnaaiklvgdkaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn2C (C:)
    pvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsnsfakllrnfnp
    mlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgeliysne
    atyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrlsgdrnplhi
    dpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetlrvlawkes
    ddtivfqthvvdrgtiainnaaiklvg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pn2D (D:)
    meddpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfa
    kllrnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnks
    geliysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrls
    gdrnplhidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetl
    rvlawkesddtivfqthvvdrgtiainnaaiklvgdkaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn2D (D:)
    pvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakllr
    nfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgeli
    ysneatyfirncqadnkvyadrpafatnqflapkrapdyqvdvpvsedlaalyrlsgdrn
    plhidpnfakgakfpkpilhgmctyglsakalidkfgmfneikarftgivfpgetlrvla
    wkesddtivfqthvvdrgtiainnaaiklvgd