PDB entry 1pn0

View 1pn0 on RCSB PDB site
Description: Phenol hydroxylase from Trichosporon cutaneum
Class: oxidoreductase
Keywords: two dimers, TLS refinement, OXIDOREDUCTASE
Deposited on 2003-06-12, released 2003-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.157
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenol 2-monooxygenase
    Species: Trichosporon cutaneum [TaxId:5554]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15245
      • see remark 999 (123)
      • see remark 999 (171-172)
      • see remark 999 (186)
      • see remark 999 (189)
      • see remark 999 (265)
      • see remark 999 (405-406)
      • see remark 999 (532)
      • see remark 999 (544)
      • see remark 999 (549-550)
    Domains in SCOPe 2.05: d1pn0a1, d1pn0a2, d1pn0a3
  • Chain 'B':
    Compound: Phenol 2-monooxygenase
    Species: Trichosporon cutaneum [TaxId:5554]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15245
      • see remark 999 (123)
      • see remark 999 (171-172)
      • see remark 999 (186)
      • see remark 999 (189)
      • see remark 999 (265)
      • see remark 999 (405-406)
      • see remark 999 (532)
      • see remark 999 (544)
      • see remark 999 (549-550)
    Domains in SCOPe 2.05: d1pn0b1, d1pn0b2, d1pn0b3
  • Chain 'C':
    Compound: Phenol 2-monooxygenase
    Species: Trichosporon cutaneum [TaxId:5554]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15245
      • see remark 999 (123)
      • see remark 999 (171-172)
      • see remark 999 (186)
      • see remark 999 (189)
      • see remark 999 (265)
      • see remark 999 (405-406)
      • see remark 999 (532)
      • see remark 999 (544)
      • see remark 999 (549-550)
    Domains in SCOPe 2.05: d1pn0c1, d1pn0c2, d1pn0c3
  • Chain 'D':
    Compound: Phenol 2-monooxygenase
    Species: Trichosporon cutaneum [TaxId:5554]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15245
      • see remark 999 (123)
      • see remark 999 (171-172)
      • see remark 999 (186)
      • see remark 999 (189)
      • see remark 999 (265)
      • see remark 999 (405-406)
      • see remark 999 (532)
      • see remark 999 (544)
      • see remark 999 (549-550)
    Domains in SCOPe 2.05: d1pn0d1, d1pn0d2, d1pn0d3
  • Heterogens: CL, FAD, IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pn0A (A:)
    mtkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcr
    tleslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgr
    ierrildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqf
    ghktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfem
    igeqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekg
    grvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdac
    hthspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerqpfaqalidfdhqfs
    rlfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncv
    vgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfaayldsen
    svisrytpkgadrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhph
    pksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadw
    tksta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn0A (A:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    errildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqfg
    hktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqatkftpe
    vvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdachthspkagqgm
    ntsmmdtynlgwklglvltgrakrdilktyeeerqpfaqalidfdhqfsrlfsgrpakdv
    ademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvvgtrfksqpvv
    rhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfaayldsensvisrytpkga
    drnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphpksyqawgvde
    tkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwtks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pn0B (B:)
    mtkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcr
    tleslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgr
    ierrildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqf
    ghktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfem
    igeqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekg
    grvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdac
    hthspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerqpfaqalidfdhqfs
    rlfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncv
    vgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfaayldsen
    svisrytpkgadrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhph
    pksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadw
    tksta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn0B (B:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    errildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqfg
    hktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqatkftpe
    vvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdachthspkagqgm
    ntsmmdtynlgwklglvltgrakrdilktyeeerqpfaqalidfdhqfsrlfsgrpakdv
    ademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvvgtrfksqpvv
    rhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfaayldsensvisrytpkga
    drnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphpksyqawgvde
    tkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwtks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pn0C (C:)
    mtkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcr
    tleslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgr
    ierrildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqf
    ghktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfem
    igeqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekg
    grvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdac
    hthspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerqpfaqalidfdhqfs
    rlfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncv
    vgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfaayldsen
    svisrytpkgadrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhph
    pksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadw
    tksta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn0C (C:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    errildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqfg
    hktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqarvdrtk
    ftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdachthspka
    gqgmntsmmdtynlgwklglvltgrakrdilktyeeerqpfaqalidfdhqfsrlfsgrp
    akdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvvgtrfks
    qpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfaayldsensvisryt
    pkgadrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphpksyqaw
    gvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwtks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pn0D (D:)
    mtkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcr
    tleslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgr
    ierrildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqf
    ghktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfem
    igeqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekg
    grvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdac
    hthspkagqgmntsmmdtynlgwklglvltgrakrdilktyeeerqpfaqalidfdhqfs
    rlfsgrpakdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncv
    vgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfaayldsen
    svisrytpkgadrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhph
    pksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadw
    tksta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pn0D (D:)
    tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
    leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
    errildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqfg
    hktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
    geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqarvdrtk
    ftpevvianakkifhpytfdvqqldwftayhigqrvtekfskdervfiagdachthspka
    gqgmntsmmdtynlgwklglvltgrakrdilktyeeerqpfaqalidfdhqfsrlfsgrp
    akdvademgvsmdvfkeafvkgnefasgtainydenlvtdkksskqelakncvvgtrfks
    qpvvrhseglwmhfgdrlvtdgrfriivfagkatdatqmsrikkfaayldsensvisryt
    pkgadrnsridvitihschrddiemhdfpapalhpkwqydfiyadcdswhhphpksyqaw
    gvdetkgavvvvrpdgytslvtdlegtaeidryfsgilvepkeksgaqteadwtks