PDB entry 1pmz

View 1pmz on RCSB PDB site
Description: Structure of the calcium-binding pollen allergen Che a 3
Class: allergen
Keywords: calcium-binding protein, dimer, domain-swapping, EF-hand protein
Deposited on 2003-06-12, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-02-06, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pollen allergen Che a 3
    Species: Chenopodium album
    Gene: AY082338
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmza_
  • Chain 'B':
    Compound: pollen allergen Che a 3
    Species: Chenopodium album
    Gene: AY082338
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmzb_
  • Chain 'C':
    Compound: pollen allergen Che a 3
    Species: Chenopodium album
    Gene: AY082338
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmzc_
  • Chain 'D':
    Compound: pollen allergen Che a 3
    Species: Chenopodium album
    Gene: AY082338
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pmzA (A:)
    maaedtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgd
    gfisfdeftdfaranrglvkdvskif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmzA (A:)
    dtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfis
    fdeftdfaranrglvkdvskif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pmzB (B:)
    maaedtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgd
    gfisfdeftdfaranrglvkdvskif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmzB (B:)
    dtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgfis
    fdeftdfaranrglvkdvskif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pmzC (C:)
    maaedtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgd
    gfisfdeftdfaranrglvkdvskif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmzC (C:)
    aedtpqdiadrerifkrfdtngdgkissselgdalktlgsvtpdevrrmmaeidtdgdgf
    isfdeftdfaranrglvkdvskif
    

  • Chain 'D':
    No sequence available.