PDB entry 1pmx

View 1pmx on RCSB PDB site
Description: insulin-like growth factor-I bound to a phage-derived peptide
Class: hormone/growth factor
Keywords: igf-I, peptide binding, high affinity ligand, hormone/growth factor complex
Deposited on 2003-06-11, released 2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-like growth factor IB
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmxa_
  • Chain 'B':
    Compound: igf-1 antagonist f1-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1PMX (0-15)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmxA (A:)
    gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
    caplkpaksa
    

  • Chain 'B':
    No sequence available.