PDB entry 1pmx

View 1pmx on RCSB PDB site
Description: insulin-like growth factor-I bound to a phage-derived peptide
Class: hormone/growth factor
Keywords: igf-I, peptide binding, high affinity ligand, hormone/growth factor complex
Deposited on 2003-06-11, released 2003-10-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Insulin-like growth factor IB
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05019 (0-69)
  Domains in SCOPe 2.01: d1pmxa_
• Chain 'B':
  Compound: igf-1 antagonist f1-1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1PMX (0-15)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pmxA (A:)
  gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
  caplkpaksa
  

  
  
• Chain 'B':
  No sequence available.