PDB entry 1pmp

View 1pmp on RCSB PDB site
Description: crystallographic studies on a family of cellular lipophilic transport proteins. refinement of p2 myelin protein and the structure determination and refinement of cellular retinol-binding protein in complex with all-trans-retinol
Class: cellular lipophilic transport protein
Keywords: cellular lipophilic transport protein
Deposited on 1993-02-10, released 1995-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.268
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p2 myelin protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pmpa_
  • Chain 'B':
    Compound: p2 myelin protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pmpb_
  • Chain 'C':
    Compound: p2 myelin protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pmpc_
  • Heterogens: OLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmpA (A:)
    snkflgtwklvssenfdeymkalgvglatrklgnlakprviiskkgdiitirtespfknt
    eisfklgqefeettadnrktkstvtlargslnqvqkwngnettikrklvdgkmvveckmk
    dvvctriyekv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmpB (B:)
    snkflgtwklvssenfdeymkalgvglatrklgnlakprviiskkgdiitirtespfknt
    eisfklgqefeettadnrktkstvtlargslnqvqkwngnettikrklvdgkmvveckmk
    dvvctriyekv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmpC (C:)
    snkflgtwklvssenfdeymkalgvglatrklgnlakprviiskkgdiitirtespfknt
    eisfklgqefeettadnrktkstvtlargslnqvqkwngnettikrklvdgkmvveckmk
    dvvctriyekv