PDB entry 1pmo

View 1pmo on RCSB PDB site
Description: Crystal structure of Escherichia coli GadB (neutral pH)
Class: lyase
Keywords: NEUTRAL-PH FORM OF GadB, LYASE
Deposited on 2003-06-11, released 2004-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmoa_
  • Chain 'B':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmob_
  • Chain 'C':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmoc_
  • Chain 'D':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmod_
  • Chain 'E':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmoe_
  • Chain 'F':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmof_
  • Heterogens: PLR, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pmoA (A:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmoA (A:)
    elldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwdden
    vhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacm
    lggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdp
    krmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggfla
    pfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqig
    tfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrp
    degipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfem
    dfaellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pmoB (B:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmoB (B:)
    kqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatf
    cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
    igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
    pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
    aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
    dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
    efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
    mcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pmoC (C:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmoC (C:)
    lldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwddenv
    hklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacml
    ggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdpk
    rmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggflap
    fvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqigt
    fainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrpd
    egipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfemd
    faellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pmoD (D:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmoD (D:)
    lldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwddenv
    hklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacml
    ggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdpk
    rmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggflap
    fvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqigt
    fainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrpd
    egipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfemd
    faellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pmoE (E:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmoE (E:)
    kqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatf
    cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
    igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
    pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
    aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
    dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
    efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
    mcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pmoF (F:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmoF (F:)
    lldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwddenv
    hklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacml
    ggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdpk
    rmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggflap
    fvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqigt
    fainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrpd
    egipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfemd
    faellledykaslkylsdhpklqgiaqqnsfkht