PDB entry 1pmm

View 1pmm on RCSB PDB site
Description: Crystal structure of Escherichia coli GadB (low pH)
Class: lyase
Keywords: LOW-PH FORM OF GadB, LYASE
Deposited on 2003-06-11, released 2004-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmma_
  • Chain 'B':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmmb_
  • Chain 'C':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmmc_
  • Chain 'D':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmmd_
  • Chain 'E':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmme_
  • Chain 'F':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli [TaxId:562]
    Gene: gadB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pmmf_
  • Heterogens: PLP, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pmmA (A:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmmA (A:)
    kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
    fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
    tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
    rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
    daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
    vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
    yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
    imcrrgfemdfaellledykaslkylsdhp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pmmB (B:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmmB (B:)
    kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
    fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
    tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
    rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
    daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
    vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
    yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
    imcrrgfemdfaellledykaslkylsdhp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pmmC (C:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmmC (C:)
    kqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatf
    cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
    igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
    pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
    aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
    dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
    efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
    mcrrgfemdfaellledykaslkylsdhp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pmmD (D:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmmD (D:)
    kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
    fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
    tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
    rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
    daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
    vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
    yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
    imcrrgfemdfaellledykaslkylsdhp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pmmE (E:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmmE (E:)
    kqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatf
    cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
    igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
    pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
    aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
    dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
    efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
    mcrrgfemdfaellledykaslkylsdhp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pmmF (F:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmmF (F:)
    kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
    fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
    tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
    rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
    daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
    vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
    yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
    imcrrgfemdfaellledykaslkylsdhp