PDB entry 1pml

View 1pml on RCSB PDB site
Description: kringle-kringle interactions in multimer kringle structures
Deposited on 1994-04-25, released 1994-06-22
The last revision prior to the SCOP 1.59 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 2.38 Å
R-factor: 0.145
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1pmla_
  • Chain 'B':
    Domains in SCOP 1.59: d1pmlb_
  • Chain 'C':
    Domains in SCOP 1.59: d1pmlc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmlA (A:)
    sdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnpdg
    dakpwchvlknrrltweycdvpscst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmlB (B:)
    sdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnpdg
    dakpwchvlknrrltweycdvpscst
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmlC (C:)
    sdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnpdg
    dakpwchvlknrrltweycdvpscs