PDB entry 1pml

View 1pml on RCSB PDB site
Description: kringle-kringle interactions in multimer kringle structures
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease)
Deposited on 1994-04-25, released 1994-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tissue plasminogen activator kringle 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pmla_
  • Chain 'B':
    Compound: tissue plasminogen activator kringle 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pmlb_
  • Chain 'C':
    Compound: tissue plasminogen activator kringle 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pmlc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmlA (A:)
    sdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnpdg
    dakpwchvlknrrltweycdvpscst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmlB (B:)
    sdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnpdg
    dakpwchvlknrrltweycdvpscst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pmlC (C:)
    sdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnpdg
    dakpwchvlknrrltweycdvpscst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmlC (C:)
    sdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnpdg
    dakpwchvlknrrltweycdvpscs