PDB entry 1pmj

View 1pmj on RCSB PDB site
Description: Crystal structure of Caldicellulosiruptor saccharolyticus CBM27-1
Class: hydrolase
Keywords: jellyroll beta-sandwich, HYDROLASE
Deposited on 2003-06-11, released 2004-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.128
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: beta-1,4-mannanase
    Species: Caldicellulosiruptor saccharolyticus [TaxId:44001]
    Gene: MANA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77847 (0-184)
      • see remark 999 (68)
      • see remark 999 (103)
    Domains in SCOPe 2.06: d1pmjx_
  • Heterogens: CA, EDO, ACY, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pmjX (X:)
    essvnpvvldfedgtvmsfgeawgdslkcikkvsvsqdlqrpgnkyalrldvefnpnngw
    dqgdlgtwiggvvegqfdftgyksvefemfipydefsksqggfaykvvindgwkelgsef
    nitanagkkvkingkdytvihkafaipedfrtkkraqlvfqfagqnsnykgpiyldnvri
    rpeda