PDB entry 1pmh

View 1pmh on RCSB PDB site
Description: Crystal structure of Caldicellulosiruptor saccharolyticus CBM27-1 in complex with mannohexaose
Class: hydrolase
Keywords: jellyroll beta-sandwich, HYDROLASE
Deposited on 2003-06-11, released 2004-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: 0.143
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: beta-1,4-mannanase
    Species: Caldicellulosiruptor saccharolyticus [TaxId:44001]
    Gene: MANA
    Database cross-references and differences (RAF-indexed):
    • GB AAC44232 (Start-184)
      • modified residue (16)
      • see remark 999 (68)
      • modified residue (88)
      • see remark 999 (103)
    Domains in SCOPe 2.06: d1pmhx_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1pmhX (X:)
    essvnpvvldfedgtvmsfgeawgdslkcikkvsvsqdlqrpgnkyalrldvefnpnngw
    dqgdlgtwiggvvegqfdftgyksvefemfipydefsksqggfaykvvindgwkelgsef
    nitanagkkvkingkdytvihkafaipedfrtkkraqlvfqfagqnsnykgpiyldnvri
    rpeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmhX (X:)
    svnpvvldfedgtvmsfgeawgdslkcikkvsvsqdlqrpgnkyalrldvefnpnngwdq
    gdlgtwiggvvegqfdftgyksvefemfipydefsksqggfaykvvindgwkelgsefni
    tanagkkvkingkdytvihkafaipedfrtkkraqlvfqfagqnsnykgpiyldnvrirp
    eda