PDB entry 1pme

View 1pme on RCSB PDB site
Description: structure of penta mutant human erk2 map kinase complexed with a specific inhibitor of human p38 map kinase
Class: transferase
Keywords: map kinase, serine/threonine protein kinase, transferase
Deposited on 1998-06-08, released 1999-06-08
The last revision prior to the SCOP 1.73 freeze date was dated 1999-06-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erk2
    Species: HOMO SAPIENS
    Gene: ERK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28482 (Start-379)
      • engineered (122)
      • engineered (124-125)
      • engineered (128-129)
      • modified (180)
    Domains in SCOP 1.73: d1pmea_
  • Heterogens: SO4, SB2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pmeA (A:)
    mssshhhhhhssglvprgshmaaaaaagagpemvrgqvfdvgprytnlsyigegaygmvc
    saydnvnkvrvaikkispfehqtycqrtlreikillrfrheniigindiiraptieqmkd
    vylvthlmgadlykllktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllntt
    cdlkicdfglarvadpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilae
    mlsnrpifpgkhyldqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfp
    nadskaldlldkmltfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpk
    eklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pmeA (A:)
    gqvfdvgprytnlsyigygmvcsaydnvnkvrvaikkispfehqtycqrtlreikillrf
    rheniigindiiraptieqmkdvylvthlmgadlykllktqhlsndhicyflyqilrglk
    yihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrwyrapei
    mlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinl
    karnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyyd
    psdepiaeapflpkeklkelifeetarfqpgyrs