PDB entry 1pmb

View 1pmb on RCSB PDB site
Description: the determination of the crystal structure of recombinant pig myoglobin by molecular replacement and its refinement
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1989-11-27, released 1990-01-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Sus scrofa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pmba_
  • Chain 'B':
    Compound: Myoglobin
    Species: Sus scrofa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pmbb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pmbA (A:)
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pmbB (B:)
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg