PDB entry 1pm9

View 1pm9 on RCSB PDB site
Description: crystal structure of human mnsod h30n, y166f mutant
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2003-06-10, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-End)
      • engineered (29)
      • engineered (165)
    Domains in SCOPe 2.07: d1pm9a1, d1pm9a2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (29)
      • engineered (165)
    Domains in SCOPe 2.07: d1pm9b1, d1pm9b2
  • Heterogens: MN3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pm9A (A:)
    khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pm9A (A:)
    khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymac
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pm9B (B:)
    khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymackk