PDB entry 1pm7

View 1pm7 on RCSB PDB site
Description: RmlC (dTDP-6-DEOXY-D-XYLO-4-HEXULOSE 3,5-EPIMERASE)STRUCTURE FROM MYCOBACTERIUM TUBERCULOSIS AND INHIBITOR DESIGN. THE APO STRUCTURE.
Class: isomerase
Keywords: RmlC, Beta Barrel, main beta sheet structure, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, ISOMERASE
Deposited on 2003-06-10, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rfbc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rmlc (rfbc)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pm7a_
  • Chain 'B':
    Compound: rfbc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: rmlc (rfbc)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pm7b_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pm7A (A:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfigemrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pm7A (A:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfigem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pm7B (B:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfigemrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pm7B (B:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfigem