PDB entry 1pm5

View 1pm5 on RCSB PDB site
Description: Crystal structure of wild type Lactococcus lactis Fpg complexed to a tetrahydrofuran containing DNA
Class: hydrolase/DNA
Keywords: DNA repair, Fpg, MutM, abasic site
Deposited on 2003-06-10, released 2004-07-27
The last revision prior to the SCOP 1.73 freeze date was dated 2004-07-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Lactococcus lactis
    Gene: MUTM or FPG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pm5a1, d1pm5a2, d1pm5a3
  • Chain 'D':
    Compound: DNA (5'-d(*cp*tp*cp*tp*tp*tp*(3dr)p*tp*tp*tp*cp*tp*cp*g)-3')
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*gp*ap*gp*ap*ap*ap*cp*ap*ap*ap*gp*a)-3')
    Species: synthetic, synthetic
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pm5A (A:)
    pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvygk
    tgekcsrcgaeiqkikvagrgthfcpvcqqk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.