PDB entry 1pm4

View 1pm4 on RCSB PDB site
Description: Crystal structure of Yersinia pseudotuberculosis-derived mitogen (YPM)
Class: toxin
Keywords: Jelly roll fold, TOXIN
Deposited on 2003-06-09, released 2004-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ypm
    Species: Yersinia pseudotuberculosis [TaxId:633]
    Gene: ypma
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pm4a_
  • Chain 'B':
    Compound: ypm
    Species: Yersinia pseudotuberculosis [TaxId:633]
    Gene: ypma
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pm4b_
  • Chain 'C':
    Compound: ypm
    Species: Yersinia pseudotuberculosis [TaxId:633]
    Gene: ypma
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pm4c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pm4A (A:)
    lripniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngw
    geikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pm4A (A:)
    ipniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngwge
    ikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pm4B (B:)
    lripniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngw
    geikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pm4B (B:)
    ipniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngwge
    ikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pm4C (C:)
    lripniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngw
    geikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pm4C (C:)
    ipniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngwge
    ikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv