PDB entry 1pm1

View 1pm1 on RCSB PDB site
Description: Crystal structure of nitrophorin 2 L122V/L132V mutant complex with imidazole
Class: blood clotting inhibitor
Keywords: beta barrel, lipocalin, imidazole, ferric heme, BLOOD CLOTTING INHIBITOR
Deposited on 2003-06-09, released 2004-06-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.155
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Nitrophorin 2
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q26241 (1-179)
    • initiating met (0)
    • engineered (122)
    • engineered (132)
  Domains in SCOPe 2.05: d1pm1x_
• Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pm1X (X:)
  mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
  ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
  icvregskdlgdvytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl