PDB entry 1plz

View 1plz on RCSB PDB site
Description: crystal structure of phosphoglucose isomerase from pyrococcus furiosus
Deposited on 2003-06-09, released 2003-06-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1plza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1plzA (A:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1plzA (A:)
    mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
    ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
    smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
    vvdnprw