PDB entry 1pls

View 1pls on RCSB PDB site
Description: solution structure of a pleckstrin homology domain
Class: phosphorylation
Keywords: phosphorylation
Deposited on 1994-05-03, released 1995-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pleckstrin homology domain
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1plsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1plsA (A:)
mepkriregylvkkgsvfntwkpmwvvlledgiefykkksdnspkgmiplkgstltspcq
dfgkrmfvfkitttkqqdhffqaafleerdawvrdinkaikcieglehhhhhh