PDB entry 1plr

View 1plr on RCSB PDB site
Description: crystal structure of the eukaryotic DNA polymerase processivity factor pcna
Class: DNA-binding
Keywords: DNA-binding, nuclear protein, DNA replication
Deposited on 1995-01-02, released 1995-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proliferating cell nuclear antigen (pcna)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1plra1, d1plra2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1plrA (A:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfndee