PDB entry 1plo

View 1plo on RCSB PDB site
Description: transforming growth factor-beta type II receptor extracellular domain
Class: Cytokine receptor
Keywords: Three-Finger Toxin Fold, Cytokine receptor
Deposited on 2003-06-08, released 2003-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: TGF-beta receptor type II
  Species: Homo sapiens [TaxId:9606]
  Gene: TGFBR2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P37173 (0-121)
    • engineered (4)
  Domains in SCOPe 2.05: d1ploa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ploA (A:)
  vtdnagavkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitl
  etvchdpklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniifseeyntsn
  pd