PDB entry 1plo

View 1plo on RCSB PDB site
Description: transforming growth factor-beta type II receptor extracellular domain
Class: Cytokine receptor
Keywords: Three-Finger Toxin Fold, Cytokine receptor
Deposited on 2003-06-08, released 2003-09-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type II
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37173 (0-121)
      • engineered (4)
    Domains in SCOPe 2.01: d1ploa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ploA (A:)
    vtdnagavkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitl
    etvchdpklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniifseeyntsn
    pd