PDB entry 1plk

View 1plk on RCSB PDB site
Description: crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points
Class: oncogene protein
Keywords: oncogene protein
Deposited on 1994-03-13, released 1994-07-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-h-ras p21 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • conflict (121)
    Domains in SCOPe 2.01: d1plka_
  • Heterogens: MG, GTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1plkA (A:)
    mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    agrtvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1plkA (A:)
    mteyklvvgggksaltqiqnhfvydiedsyrkqvvidgtcllddtagqeeysamrdymrt
    gegfvfainntksfedihqyreqikrkdsddvpmlvgnkcdlagrtvesrqadarsygie
    tsaktrqvedafylvreirqh