PDB entry 1plg

View 1plg on RCSB PDB site
Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid
Deposited on 1995-04-24, released 1996-04-03
The last revision prior to the SCOP 1.69 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.164
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1plgH (H:)
    qiqlqqsgpelvrpgasvkisckasgytftdyyihwvkqrpgeglewigwiypgsgntky
    nekfkgkatltvdtssstaymqlssltsedsavyfcarggkfamdywgqgtsvtvssakt
    tapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtsstwpsqsitcnvahpasstkvdkkie
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1plgL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylywylqkpgqspkpliyrvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcfqgthvpytfgggtrleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfn