PDB entry 1plc

View 1plc on RCSB PDB site
Description: accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1992-03-11, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.15
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin
  Species: Populus nigra
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00299 (0-98)
  Domains in SCOP 1.75: d1plca_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1plcA (A:)
  idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
  dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn