PDB entry 1plc

View 1plc on RCSB PDB site
Description: accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution
Deposited on 1992-03-11, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.33 Å
R-factor: 0.15
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1plc__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1plc_ (-)
  idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
  dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn