PDB entry 1pl4

View 1pl4 on RCSB PDB site
Description: Crystal Structure of human MnSOD Y166F mutant
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2003-06-06, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (165)
    Domains in SCOPe 2.07: d1pl4a1, d1pl4a2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-End)
      • engineered (165)
    Domains in SCOPe 2.07: d1pl4b1, d1pl4b2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-End)
      • engineered (165)
    Domains in SCOPe 2.07: d1pl4c1, d1pl4c2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-End)
      • engineered (165)
    Domains in SCOPe 2.07: d1pl4d1, d1pl4d2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pl4A (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pl4B (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pl4B (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymac
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pl4C (C:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pl4C (C:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymack
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pl4D (D:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pl4D (D:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayflqyknvrpdylkai
    wnvinwenvterymack