PDB entry 1pky

View 1pky on RCSB PDB site
Description: pyruvate kinase from e. coli in the t-state
Class: phosphotransferase
Keywords: allostery, phosphotransferase
Deposited on 1995-04-27, released 1995-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • conflict (278)
    Domains in SCOPe 2.06: d1pkya1, d1pkya2, d1pkya3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • conflict (278)
    Domains in SCOPe 2.06: d1pkyb1, d1pkyb2, d1pkyb3
  • Chain 'C':
    Compound: pyruvate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • conflict (278)
    Domains in SCOPe 2.06: d1pkyc1, d1pkyc2, d1pkyc3
  • Chain 'D':
    Compound: pyruvate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • conflict (278)
    Domains in SCOPe 2.06: d1pkyd1, d1pkyd2, d1pkyd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pkyA (A:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkyA (A:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrleklriteavcrgaveta
    ekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlvkeitst
    ddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pkyB (B:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkyB (B:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrleklriteavcrgaveta
    ekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlvkeitst
    ddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pkyC (C:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkyC (C:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirmvavtyegfttdlsvgntvlvddgligmevtaiegnkvickvlnngd
    lgenkgvnlpgvsialpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahg
    genihiiskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirar
    kvvitatmmldsmiknprptraeagdvanaildgtdavmlsgesakgkypleavsimati
    certdrvmnsrleklriteavcrgavetaekldaplivvatqggksaravrkyfpdatil
    alttnektahqlvlskgvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalv
    psgttntasvhvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pkyD (D:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkyD (D:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrleklriteavcrgaveta
    ekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlvkeitst
    ddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl