PDB entry 1pkv

View 1pkv on RCSB PDB site
Description: The N-terminal domain of riboflavin synthase in complex with riboflavin
Class: transferase
Keywords: dimer, beta-barrel, greek key motif, TRANSFERASE
Deposited on 2003-06-06, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.177
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: riboflavin synthase alpha chain
    Species: Escherichia coli [TaxId:562]
    Gene: RIBE OR RIBC OR B1662 OR SF1690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pkva_
  • Chain 'B':
    Compound: riboflavin synthase alpha chain
    Species: Escherichia coli [TaxId:562]
    Gene: RIBE OR RIBC OR B1662 OR SF1690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pkvb_
  • Heterogens: RBF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1pkvA (A:)
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh

    Sequence, based on observed residues (ATOM records): (download) 
    >1pkvA (A:)
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnvera

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1pkvB (B:)
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh

    Sequence, based on observed residues (ATOM records): (download) 
    >1pkvB (B:)
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnvera