PDB entry 1pku

View 1pku on RCSB PDB site
Description: Crystal Structure of Nucleoside Diphosphate Kinase from Rice
Class: transferase
Keywords: nucleoside diphosphate kinase, rice, TRANSFERASE
Deposited on 2003-06-06, released 2005-02-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkua1
  • Chain 'B':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkub_
  • Chain 'C':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkuc_
  • Chain 'D':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkud_
  • Chain 'E':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkue_
  • Chain 'F':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkuf_
  • Chain 'G':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkug_
  • Chain 'H':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkuh_
  • Chain 'I':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkui_
  • Chain 'J':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkuj_
  • Chain 'K':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkuk_
  • Chain 'L':
    Compound: Nucleoside Diphosphate Kinase I
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07661 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.03: d1pkul_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pkuA (A:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuA (A:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pkuB (B:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuB (B:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pkuC (C:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuC (C:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pkuD (D:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuD (D:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pkuE (E:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuE (E:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pkuF (F:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuF (F:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pkuG (G:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuG (G:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pkuH (H:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuH (H:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1pkuI (I:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuI (I:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1pkuJ (J:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuJ (J:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1pkuK (K:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuK (K:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1pkuL (L:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkuL (L:)
    rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
    glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
    vdngkkeialwfpeglaewrsnlhpwiye