SCOPe 2.02: Structural Classification of Proteins

PDB entry 1pku

View 1pku on RCSB PDB site
Description: Crystal Structure of Nucleoside Diphosphate Kinase from Rice
Class: transferase
Keywords: nucleoside diphosphate kinase, rice, TRANSFERASE
Deposited on 2003-06-06, released 2005-02-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkua1
Chain 'B':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkub_
Chain 'C':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkuc_
Chain 'D':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkud_
Chain 'E':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkue_
Chain 'F':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkuf_
Chain 'G':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkug_
Chain 'H':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkuh_
Chain 'I':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkui_
Chain 'J':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkuj_
Chain 'K':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkuk_
Chain 'L':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.02: d1pkul_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1pkuA (A:)
rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
vdngkkeialwfpeglaewrsnlhpwiyes