SCOPe 2.08: Structural Classification of Proteins

PDB entry 1pku

View 1pku on RCSB PDB site
Description: Crystal Structure of Nucleoside Diphosphate Kinase from Rice
Class: transferase
Keywords: nucleoside diphosphate kinase, rice, TRANSFERASE
Deposited on 2003-06-06, released 2005-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkua1, d1pkua2
Chain 'B':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkub2, d1pkub3
Chain 'C':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkuc2, d1pkuc3
Chain 'D':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkud2, d1pkud3
Chain 'E':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkue2, d1pkue3
Chain 'F':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkuf2, d1pkuf3
Chain 'G':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkug2, d1pkug3
Chain 'H':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkuh2, d1pkuh3
Chain 'I':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkui2, d1pkui3
Chain 'J':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkuj2, d1pkuj3
Chain 'K':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkuk2, d1pkuk3
Chain 'L':
Compound: Nucleoside Diphosphate Kinase I
Species: Oryza sativa [TaxId:4530]
Database cross-references and differences (RAF-indexed):
- Uniprot Q07661 (1-End)
  - cloning artifact (0)
Domains in SCOPe 2.08: d1pkul2, d1pkul3
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1pkuA (A:)
rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
vdngkkeialwfpeglaewrsnlhpwiyes