PDB entry 1pks

View 1pks on RCSB PDB site
Description: structure of the pi3k sh3 domain and analysis of the sh3 family
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1994-03-07, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pksa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1pksA (A:)
msaegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngyn
ettgergdfpgtyveyigr

    Sequence, based on observed residues (ATOM records): (download) 
    >1pksA (A:)
egyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynett
gergdfpgtyveyigr