PDB entry 1pkq

View 1pkq on RCSB PDB site
Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex
Class: immune system
Keywords: autoantibody, multiple sclerosis, EAE, IMMUNE SYSTEM
Deposited on 2003-06-06, released 2003-07-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.25
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (8-18C5) chimeric Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Gene: Ig light chain
    Database cross-references and differences (RAF-indexed):
    • PDB 1PKQ
    Domains in SCOPe 2.01: d1pkqa1, d1pkqa2
  • Chain 'B':
    Compound: (8-18C5) chimeric Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Ig heavy chain
    Database cross-references and differences (RAF-indexed):
    • PDB 1PKQ
    Domains in SCOPe 2.01: d1pkqb1, d1pkqb2
  • Chain 'E':
    Compound: Myelin Oligodendrocyte Glycoprotein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: mog
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pkqe_
  • Chain 'F':
    Compound: (8-18C5) chimeric Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Gene: Ig light chain
    Database cross-references and differences (RAF-indexed):
    • PDB 1PKQ
    Domains in SCOPe 2.01: d1pkqf1, d1pkqf2
  • Chain 'G':
    Compound: (8-18C5) chimeric Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Ig heavy chain
    Database cross-references and differences (RAF-indexed):
    • PDB 1PKQ
    Domains in SCOPe 2.01: d1pkqg1, d1pkqg2
  • Chain 'J':
    Compound: Myelin Oligodendrocyte Glycoprotein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: mog
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63345 (4-End)
      • cloning artifact (4)
      • cloning artifact (4)
    Domains in SCOPe 2.01: d1pkqj_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pkqA (A:)
    mkqstialallpllftpvtkadieltqspsslavsagekvtmsckssqsllnsgnqknyl
    awyqqkpglppklliygastresgvpdrftgsgsgtdftltissvqaedlavyycqndhs
    ypltfgagtkleikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdna
    lqsgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqA (A:)
    dieltqspsslavsagekvtmsckssqsllnsgnqknylawyqqkpglppklliygastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pkqB (B:)
    mkktaiaiavalagfatvaqaevklhesgaglvkpgasveisckatgytfssfwiewvkq
    rpghglewigeilpgrgrtnynekfkgkatftaetssntaymqlssltsedsavyycatg
    ntmvnmpywgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvsw
    nsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    scsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqB (B:)
    evklhesgaglvkpgasveisckatgytfssfwiewvkqrpghglewigeilpgrgrtny
    nekfkgkatftaetssntaymqlssltsedsavyycatgntmvnmpywgqgttvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pkqE (E:)
    mrgsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkd
    qdaeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkve
    dpfywinpgrsrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqE (E:)
    gsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqd
    aeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp
    f
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pkqF (F:)
    mkqstialallpllftpvtkadieltqspsslavsagekvtmsckssqsllnsgnqknyl
    awyqqkpglppklliygastresgvpdrftgsgsgtdftltissvqaedlavyycqndhs
    ypltfgagtkleikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdna
    lqsgnsqesvteqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
    c
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqF (F:)
    dieltqspsslavsagekvtmsckssqsllnsgnqknylawyqqkpglppklliygastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pkqG (G:)
    mkktaiaiavalagfatvaqaevklhesgaglvkpgasveisckatgytfssfwiewvkq
    rpghglewigeilpgrgrtnynekfkgkatftaetssntaymqlssltsedsavyycatg
    ntmvnmpywgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvsw
    nsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    scsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqG (G:)
    evklhesgaglvkpgasveisckatgytfssfwiewvkqrpghglewigeilpgrgrtny
    nekfkgkatftaetssntaymqlssltsedsavyycatgntmvnmpywgqgttvtvssas
    tkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1pkqJ (J:)
    mrgsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkd
    qdaeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkve
    dpfywinpgrsrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkqJ (J:)
    gqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdae
    qapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp