PDB entry 1pkp

View 1pkp on RCSB PDB site
Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rRNA
Class: ribosomal protein
Keywords: ribosomal protein
Deposited on 1993-08-30, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s5
    Species: Bacillus stearothermophilus
    Gene: BACILLUS STEAROTHERMOPHILUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1pkpa1, d1pkpa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pkpA (A:)
    mrrinpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeai
    rkaiedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagi
    sdilsksigsntpinmvratfdglkqlkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkpA (A:)
    inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
    iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
    lsksigsntpinmvratfdglkqlk